Recombinant Human STELLAR Protein (denatured)

Beta LifeScience SKU/CAT #: BLA-8538P
Recombinant Human STELLAR Protein (denatured)

Recombinant Human STELLAR Protein (denatured)

Beta LifeScience SKU/CAT #: BLA-8538P
Catalog No.: BLA-8538P

Product Overview

Host Species Human
Accession Q6W0C5
Synonym Compaction associated protein 1 Developmental pluripotency associated 3 Developmental pluripotency associated protein 3 Developmental pluripotency-associated protein 3 Dppa3 DPPA3_HUMAN PGC7 Stella related protein Stella-related protein
Description Recombinant Human STELLAR Protein (denatured) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMGSMDPSQFNPTYIPGSPQMLTEENSRDDS GASQISSETLIKNLSNLTINASSESVSPLSEALLRRESVGAAVLREIEDE WLYSRRGVRTLLSVQREKMARLRYMLLGGVRTHERRPTNKEPKGVKKESR PFKCPCSFCVSNGWDPSENARIGNQDTKPLQP
Molecular Weight 20 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed