Recombinant Human STCH Protein

Beta LifeScience SKU/CAT #: BLA-8534P
Recombinant Human STCH Protein

Recombinant Human STCH Protein

Beta LifeScience SKU/CAT #: BLA-8534P
Catalog No.: BLA-8534P

Product Overview

Host Species Human
Accession P48723
Synonym Heat shock 70 kDa protein 13 HEAT SHOCK 70-KD PROTEIN 13 heat shock protein 70kDa family, member 13 heat shock protein70kDa family, member13 HSP13_HUMAN HSPA13 MGC133835 Microsomal stress 70 protein ATPase core Microsomal stress-70 protein ATPase core STCH Stress 70 protein chaperone microsome associated 60 kDa protein Stress-70 protein chaperone microsome-associated 60 kDa protein
Description Recombinant Human STCH Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSELEMQQYLPLPTPK VIGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVGY ESVELADSNPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEF SVTSNETITVSPEYVGSRLLLKLKEMAEAYLGMPVANAVISVPAEFDLKQ RNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADVFHVLVIDLGGGTLD VSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPSRK EEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDK LSSADDHRVNSGFGRGLSDKKSGESQVLFETEISRKLFDTLNEDLFQKIL VPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQEFFGKDPNTSVDP DLAVVTGVAIQAGIDGGFWPLQVSALEIPNKHLQKTNFN
Molecular Weight 54 kDa including tags
Purity Greater than 95% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle.
Recently viewed