Recombinant Human STAT6 Protein

Beta LifeScience SKU/CAT #: BLA-8529P
Recombinant Human STAT6 Protein

Recombinant Human STAT6 Protein

Beta LifeScience SKU/CAT #: BLA-8529P
Catalog No.: BLA-8529P

Product Overview

Host Species Human
Accession P42226
Synonym 12S1644 D12S1644 IL 4 STAT IL-4 Stat IL4 STAT Interleukin 4 Induced Interleukin 4 Induced Transcription Factor IL4 STAT Signal transducer and activator of transcription 6 Signal Transducer And Activator Of Transcription 6 Interleukin 4 Induced Signal Transducer And Activator Of Transcription 6 Nirs Variant 1 Signal transducer and activator of transcription 6, interleukin 4 induced STAT 6 STAT interleukin4 induced STAT, interleukin4 induced Stat6 STAT6_HUMAN STAT6B STAT6C Transcription factor IL 4 STAT
Description Recombinant Human STAT6 Protein was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence MSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQMPTMVPSYDLGMA PDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQM PPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQ PVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQ PSHYGQSGISMSLEHHHHHH
Molecular Weight 24 kDa including tags
Purity >95% SDS-PAGE.Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed