Recombinant Human STAT1 Protein (BSA and azide free)

Beta LifeScience SKU/CAT #: BLA-8511P
Recombinant Human STAT1 Protein (BSA and azide free)

Recombinant Human STAT1 Protein (BSA and azide free)

Beta LifeScience SKU/CAT #: BLA-8511P
Catalog No.: BLA-8511P

Product Overview

Host Species Human
Accession P42224-2
Synonym Signal transducer and activator of transcription 1 91kD CANDF7 DKFZp686B04100 IMD31A IMD31B IMD31C ISGF 3 ISGF-3 OTTHUMP00000163552 OTTHUMP00000165046 OTTHUMP00000165047 OTTHUMP00000205845 Signal transducer and activator of transcription 1 Signal transducer and activator of transcription 1 91kDa Signal transducer and activator of transcription 1, 91kD Signal transducer and activator of transcription 1-alpha/beta STAT 1 Stat1 STAT1_HUMAN STAT91 Transcription factor ISGF 3 components p91 p84 Transcription factor ISGF-3 components p91/p84 Transcription factor ISGF3 components p91/p84 XStat1
Description Recombinant Human STAT1 Protein (BSA and azide free) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence GSHMSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAA NDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQED PIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVR NVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQL LLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWKRRQQSAC IGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKN KQVLWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRL LVKLQELNYNLKVKVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTN GSLAAEFRHLQLKEQKNAGTRTNEGPLIVTEELHSLSFETQLCQPGLVID LETTSLPVVVISNVSQLPSGWASILWYNMLVAEPRNLSFFLTPPCARWAQ LSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWTRFCKENI NDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPG TFLLRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDI IRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPK GTGYIKTELISVSEV
Molecular Weight 83 kDa
Purity >95% SDS-PAGE.Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed