Recombinant Human ST6GALNAC2 Protein
Beta LifeScience
SKU/CAT #: BLA-8497P
Recombinant Human ST6GALNAC2 Protein
Beta LifeScience
SKU/CAT #: BLA-8497P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | (alpha N acetylneuraminyl 2 3 beta galactosyl 1 3) N acetyl galactosaminide alpha 2 6 sialyltransferase (alpha N acetylneuraminyl 2 3 beta galactosyl 1 3) N acetyl galactosaminide B Alpha N acetylgalactosaminide alpha 2 6 sialyltransferase 2 FLJ45660 GalNAc alpha 2 6 sialyltransferase II SAITL1 Sialyltransferase 7 Sialyltransferase 7B Sialyltransferase like 1 Sialyltransferase7 SIAT7 SIAT7B SIATL1 ST6 (alpha N acetyl neuraminyl 2 3 beta galactosyl 1 3) N acetylgalactosaminide alpha 2 6 sialyltransferase 2 ST6GalNAc II ST6GalNAII SThM |
Description | Recombinant Human ST6GALNAC2 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MGLPRGSFFWLLLLLTAACSGLLFALYFSAVQRYPGPAAGARDTTSFEAF FQSKASNSWTGKGQACRHLLHLAIQRHPHFRGLFNLSIPVLLWGDLFTPA LWDRLSQHKAPYGWRGLSHQVIASTLSLLNGSESAKLFAPPRDTPPKCIR CAVVGNGGILNGSRQGPNIDAHDYVFRLNGAVIKGFERDVGTKTSFYGFT VNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVP EGLDKGDRPHAYFGPEASASKFKLLHPDFISYLTERFLKSKLINTHFGDL YMPSTGALMLLTALHTCDQVSAYGFITSNYWKFSDHYFERKMKPLIFYAN HDLSLEAALWRDLHKAGILQLYQR |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |