Recombinant Human ST6GALNAC2 Protein

Beta LifeScience SKU/CAT #: BLA-8497P
Recombinant Human ST6GALNAC2 Protein

Recombinant Human ST6GALNAC2 Protein

Beta LifeScience SKU/CAT #: BLA-8497P
Catalog No.: BLA-8497P

Product Overview

Host Species Human
Synonym (alpha N acetylneuraminyl 2 3 beta galactosyl 1 3) N acetyl galactosaminide alpha 2 6 sialyltransferase (alpha N acetylneuraminyl 2 3 beta galactosyl 1 3) N acetyl galactosaminide B Alpha N acetylgalactosaminide alpha 2 6 sialyltransferase 2 FLJ45660 GalNAc alpha 2 6 sialyltransferase II SAITL1 Sialyltransferase 7 Sialyltransferase 7B Sialyltransferase like 1 Sialyltransferase7 SIAT7 SIAT7B SIATL1 ST6 (alpha N acetyl neuraminyl 2 3 beta galactosyl 1 3) N acetylgalactosaminide alpha 2 6 sialyltransferase 2 ST6GalNAc II ST6GalNAII SThM
Description Recombinant Human ST6GALNAC2 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MGLPRGSFFWLLLLLTAACSGLLFALYFSAVQRYPGPAAGARDTTSFEAF FQSKASNSWTGKGQACRHLLHLAIQRHPHFRGLFNLSIPVLLWGDLFTPA LWDRLSQHKAPYGWRGLSHQVIASTLSLLNGSESAKLFAPPRDTPPKCIR CAVVGNGGILNGSRQGPNIDAHDYVFRLNGAVIKGFERDVGTKTSFYGFT VNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVP EGLDKGDRPHAYFGPEASASKFKLLHPDFISYLTERFLKSKLINTHFGDL YMPSTGALMLLTALHTCDQVSAYGFITSNYWKFSDHYFERKMKPLIFYAN HDLSLEAALWRDLHKAGILQLYQR
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed