Recombinant Human SSSCA1 Protein (denatured)

Beta LifeScience SKU/CAT #: BLA-8485P
Recombinant Human SSSCA1 Protein (denatured)

Recombinant Human SSSCA1 Protein (denatured)

Beta LifeScience SKU/CAT #: BLA-8485P
Catalog No.: BLA-8485P

Product Overview

Host Species Human
Accession O60232
Synonym 1500016H19Rik Autoantigen p27 C184L centromeric autoantigen (27kD) OTTHUMP00000232769 OTTHUMP00000233069 OTTHUMP00000233071 p27 Sjoegren syndrome/scleroderma autoantigen 1 Sjogren syndrome/scleroderma autoantigen 1 Sjogren's syndrome/scleroderma autoantigen 1 homolog SSA27_HUMAN SSSCA1
Description Recombinant Human SSSCA1 Protein (denatured) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMGSMALNGAEVDDFSWEPPTEAETKVLQAR RERQDRISRLMGDYLLRGYRMLGETCADCGTILLQDKQRKIYCVACQELD SDVDKDNPALNAQAALSQAREHQLASASELPLGSRPAPQPPVPRPEHCEG AAAGLKAAQGPPAPAVPPNTDVMACTQTALLQKLTWASAELGSSTSLETS IQLCGLIRACAEALRSLQQLQH
Molecular Weight 24 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed