Recombinant Human SRP14 Protein

Beta LifeScience SKU/CAT #: BLA-8470P
Recombinant Human SRP14 Protein

Recombinant Human SRP14 Protein

Beta LifeScience SKU/CAT #: BLA-8470P
Catalog No.: BLA-8470P

Product Overview

Host Species Human
Accession P37108
Synonym 18 kDa Alu RNA binding protein 18 kDa Alu RNA-binding protein Alu RNA-binding protein, 14-KD subunit ALURBP MGC14326 Signal recognition particle 14 kDa protein signal recognition particle 14kDa (homologous Alu RNA binding protein) SRP 14 SRP14 SRP14_HUMAN
Description Recombinant Human SRP14 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMGSHMVLLESEQFLTELTRLFQKCRTSGSV YITLKKYDGRTKPIPKKGTVEGFEPADNKCLLRATDGKKK ISTVVSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKTKKTKAAAAAAAAA PAAAATAATTAATTAATAAQ
Molecular Weight 17 kDa including tags
Purity Greater than 85% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed