Recombinant Human SPOCK3 Protein
Beta LifeScience
SKU/CAT #: BLA-8446P
Recombinant Human SPOCK3 Protein
Beta LifeScience
SKU/CAT #: BLA-8446P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | HSAJ1454 OTTHUMP00000219853 OTTHUMP00000219854 OTTHUMP00000219857 OTTHUMP00000219858 OTTHUMP00000219862 OTTHUMP00000219864 OTTHUMP00000219865 OTTHUMP00000219866 OTTHUMP00000219867 OTTHUMP00000219868 Sparc/osteonectin, cwcv and kazal like domains proteoglycan (testican) 3 SPARC/osteonectin, CWCV, and Kazal like domains proteoglycan 3 TES 3 testican 3 TICN3 |
Description | Recombinant Human SPOCK3 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | RGPILSTCKQCPVVYPSPVCGSDGHTYSFQCKLEYQACVLGKQISVKCEG HCPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKT |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |