Recombinant Human SPOCK3 Protein

Beta LifeScience SKU/CAT #: BLA-8446P
Recombinant Human SPOCK3 Protein

Recombinant Human SPOCK3 Protein

Beta LifeScience SKU/CAT #: BLA-8446P
Catalog No.: BLA-8446P

Product Overview

Host Species Human
Synonym HSAJ1454 OTTHUMP00000219853 OTTHUMP00000219854 OTTHUMP00000219857 OTTHUMP00000219858 OTTHUMP00000219862 OTTHUMP00000219864 OTTHUMP00000219865 OTTHUMP00000219866 OTTHUMP00000219867 OTTHUMP00000219868 Sparc/osteonectin, cwcv and kazal like domains proteoglycan (testican) 3 SPARC/osteonectin, CWCV, and Kazal like domains proteoglycan 3 TES 3 testican 3 TICN3
Description Recombinant Human SPOCK3 Protein was expressed in Wheat germ. It is a Protein fragment
Source Wheat germ
AA Sequence RGPILSTCKQCPVVYPSPVCGSDGHTYSFQCKLEYQACVLGKQISVKCEG HCPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKT
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed