Recombinant Human Sphingosine 1 phosphate phosphatase 2 Protein

Beta LifeScience SKU/CAT #: BLA-8433P
Recombinant Human Sphingosine 1 phosphate phosphatase 2 Protein

Recombinant Human Sphingosine 1 phosphate phosphatase 2 Protein

Beta LifeScience SKU/CAT #: BLA-8433P
Catalog No.: BLA-8433P

Product Overview

Host Species Human
Synonym FLJ39004 hSPP2 SGPP2 Sphingosine 1 Phosphatase 2 SPP2 SPPase 2
Description Recombinant Human Sphingosine 1 phosphate phosphatase 2 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MAELLRSLQDSQLVARFQRRCGLFPAPDEGPRENGADPTERAARVPGVEH LPAANGKGGEAPANGLRRAAAPEAYVQKYVVKNYFYYYLFQFSAALGQEV FYITFLPFTHWNIDPYLSRRLIIIWVLVMYIGQVAKDVLKWPRPSSPPVV KLEKRLIAEYGMPSTHAMAATAIAFTLLISTMDRYQYPFVLGLVMAVVFS TLVCLSRLYTGMHTVLDVLGGVLITALLIVLTYPAWTFIDCLDSASPLFP VCVIVVPFFLCYNYPVSDYYSPTRADTTTILAAGAGVTIGFWINHFFQLV SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL YSWFKVVTRNKEARRRLEIEVPYKFVTYTSVGICATTFVPMLHRFLGLP
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed