Recombinant Human SPATS2 Protein

Beta LifeScience SKU/CAT #: BLA-8428P
Recombinant Human SPATS2 Protein

Recombinant Human SPATS2 Protein

Beta LifeScience SKU/CAT #: BLA-8428P
Catalog No.: BLA-8428P

Product Overview

Host Species Human
Synonym Nbla00526 p59scr SCR59 Serine-rich spermatocytes and round spermatid 59 kDa protein SPAS2_HUMAN SPATA10 Spats2 Spermatogenesis-associated serine-rich protein 2
Description Recombinant Human SPATS2 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MSRKQNQKDSSGFIFDLQSNTVLAQGGAFENMKEKINAVRAIVPNKSNNE IILVLQHFDNCVDKTVQAFMEGSASEVLKEWTVTGKKKNKKKKNKPKPAA EPSNGIPDSSKSVSIQEEQSAPSSEKGGMNGYHVNGAINDTESVDSLSEG LETLSIDARELEDPESAMLDTLDRTGSMLQNGVSDFETKSLTMHSIHNSQ QPRNAAKSLSRPTTETQFSNMGMEDVPLATSKKLSSNIEKSVKDLQRCTV SLARYRVVVKEEMDASIKKMKQAFAELESCLMDREVALLAEMDKVKAEAM EILLSRQKKAELLKKMTHVAVQMSEQQLVELRADIKHFVSERKYDEDLGR VARFTCDVETLKKSIDSFGQVSHPKNSYSTRSRCSSVTSVSLSSPSDASA ASSSTCASPPSLTSANKKNFAPGETPAAIANSSGQPYQPLREVLPGNRRG GQGYRPQGQKSNDPMNQGRHDSMGRYRNSSWYSSGSRYQSAPSQAPGNTI ERGQTHSAGTNGTGVSMEPSPPTPSFKKGLPQRKPRTSQTEAVNS
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed