Recombinant Human SPARC Protein (His Tag)
Beta LifeScience
SKU/CAT #: BL-4227PS

Recombinant Human SPARC Protein (His Tag)
Beta LifeScience
SKU/CAT #: BL-4227PS
Catalog No.: BL-4227PS
Product Overview
Tag | His |
Host Species | Human |
Synonym | Osteonectin, ON, Basement-membrane protein 40, BM-40, SPARC, Secreted Protein acidic and Rich in Cysteine. |
Background | SPARC, an acronym for -€œsecreted protein, acidic and rich in cysteine-€, is also known as osteonectin or BM-40. It is the founding member of a family of secreted matricellular proteins with similar domain structure. The 303 amino acid, 43 kDa protein contains a 17 aa signal sequence, an N-terminal acidic region that binds calcium, a follistatin domain containing Kazal-like sequences, and a C-terminal extracellular calcium (EC) binding domain with two EF-hand motifs. SPARC is expressed by fibroblasts, capillary endothelial cells, platelets and macrophages, especially in areas of tissue morphogenesis and remodeling. SPARC shows context-specific effects, but generally inhibits adhesion, spreading and proliferation, and promotes collagen matrix formation. For endothelial cells, SPARC disrupts focal adhesions and binds and sequesters PDGF-and VEGF. SPARC is abundantly expressed in bone, where it promotes osteoblast differentiation and inhibits adipogenesis. |
Description | Osteonectin Human Recombinant fused with 6X His tag expressed in E.Coli is a single, non-glycosylated, polypeptide chain containing 295a.a. and having a molecular weight of 34 kDa.SPARC is expressed with a 6a.a. His tag at N-Terminus and purified by unique purification methods. |
Source | E.coli |
AA Sequence | MSYYHHHHHHPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI. |
Purity | >95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Endotoxin | <1.0 EU per μg by the LAL method. |
Formulation | The SPARC (1 mg/ml) was lyophilized after extensive dialyses against 20mM PBS pH-7.4. |
Stability | Recombinant protein is stable for 12 months at -70°C |
Usage | For Research Use Only |
Storage | Lyophilized Osteonectin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BM-40 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |