Recombinant Human SPAM1 Protein
Beta LifeScience
SKU/CAT #: BLA-8420P
Recombinant Human SPAM1 Protein
Beta LifeScience
SKU/CAT #: BLA-8420P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P38567 |
Synonym | epididymis secretory sperm binding protein Li 96n HEL-S-96n HYA1 HYAL PH-20 HYAL PH20 Hyal-PH20 HYAL1 HYAL3 HYAL5 HYALP_HUMAN Hyaluronidase PH-20 Hyaluronoglucosaminidase PH-20 MGC26532 PH-20 Hyaluronidase PH20 PH20 Hyaluronidase SPAG15 SPAM-1 Spam1 Sperm adhesion molecule 1 sperm adhesion molecule 1 (PH-20 hyaluronidase, zona pellucida binding) Sperm surface protein PH-20 Sperm surface protein PH20 zona pellucida binding |
Description | Recombinant Human SPAM1 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MGVLKFKHIFFRSFVKSSGVSQIVFTFLLIPCCLTLNFRAPPVIPNVPFL WAWNAPSEFCLGKFDEPLDMSLFSFIGSPRINATGQGVTIFYVDRLGYYP YIDSITGVTVNGGIPQKISLQDHLDKAKKDITFYMPVDNLGMAVIDWEEW RPTWARNWKPKDVYKNRSIELVQQQNVQLSLTEATEKAKQEFEKAGKDFL VETIKLGKLLRPNHLWGYYLFPDCYNHHYKKPGYNGSCFNVEIKRNDDLS WLWNESTALYPSIYLNTQQSPVAATLYVRNRVREAIRVSKIPDAKSPLPV FAYTRIVFTDQVLKFLSQDELVYTFGETVALGASGIVIWGTLSIMRSMKS CLLLDNYMETILNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSSDYLHL NPDNFAIQLEKGGKFTVRGKPTLEDLEQFSEKFYCSCYSTLSCKEKADVK DTDAVDVCIADGVCIDAFLKPPMETEEPQIFYNASPSTLSATMFIVSILF LIISSVASL |
Molecular Weight | 84 kDa |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Involved in sperm-egg adhesion. Upon fertilization sperm must first penetrate a layer of cumulus cells that surrounds the egg before reaching the zona pellucida. The cumulus cells are embedded in a matrix containing hyaluronic acid which is formed prior to ovulation. This protein aids in penetrating the layer of cumulus cells by digesting hyaluronic acid. |
Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. |
Protein Families | Glycosyl hydrolase 56 family |
Database References | |
Tissue Specificity | Testis. |
Gene Functions References
- Human posterior head 20 (hPH20) and homo sapiens sperm acrosome associated 1 (hSPACA1) immunocontraceptive epitopes reduced fertility in male/female mice. PMID: 25209425
- results indicate that neither rHuPH20 nor its directly generated HA catabolites have inflammatory properties in the air pouch model, and rHuPH20 can instead inhibit some aspects of inflammation, such as neutrophil infiltration into the air pouch. PMID: 24778442
- HSPA2 regulates the expression of sperm surface receptors involved in human sperm-oocyte recognition, such as arylsulfatase A and SPAM1. PMID: 23247813
- The interaction between SPAM1, ARSA and HSPA2 in a multimeric complex mediating sperm-egg interaction. PMID: 23209833
- PH20 is elevated in demyelinating lesions and that increased PH20 expression is sufficient to inhibit oligodendrocyte precursor cell maturation and remyelination. PMID: 23463525
- SPAM1 mRNA & protein occur in all 3 regions of epididymis & vas deferens. It has hyaluronidase activity at pH 7.0. The proximal promoter has epididymal transcription factor sites including androgen receptor elements. Its role may be in sperm maturation. PMID: 12932297