Recombinant Human SPAM1 Protein

Beta LifeScience SKU/CAT #: BLA-8420P
Recombinant Human SPAM1 Protein

Recombinant Human SPAM1 Protein

Beta LifeScience SKU/CAT #: BLA-8420P
Catalog No.: BLA-8420P

Product Overview

Host Species Human
Accession P38567
Synonym epididymis secretory sperm binding protein Li 96n HEL-S-96n HYA1 HYAL PH-20 HYAL PH20 Hyal-PH20 HYAL1 HYAL3 HYAL5 HYALP_HUMAN Hyaluronidase PH-20 Hyaluronoglucosaminidase PH-20 MGC26532 PH-20 Hyaluronidase PH20 PH20 Hyaluronidase SPAG15 SPAM-1 Spam1 Sperm adhesion molecule 1 sperm adhesion molecule 1 (PH-20 hyaluronidase, zona pellucida binding) Sperm surface protein PH-20 Sperm surface protein PH20 zona pellucida binding
Description Recombinant Human SPAM1 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MGVLKFKHIFFRSFVKSSGVSQIVFTFLLIPCCLTLNFRAPPVIPNVPFL WAWNAPSEFCLGKFDEPLDMSLFSFIGSPRINATGQGVTIFYVDRLGYYP YIDSITGVTVNGGIPQKISLQDHLDKAKKDITFYMPVDNLGMAVIDWEEW RPTWARNWKPKDVYKNRSIELVQQQNVQLSLTEATEKAKQEFEKAGKDFL VETIKLGKLLRPNHLWGYYLFPDCYNHHYKKPGYNGSCFNVEIKRNDDLS WLWNESTALYPSIYLNTQQSPVAATLYVRNRVREAIRVSKIPDAKSPLPV FAYTRIVFTDQVLKFLSQDELVYTFGETVALGASGIVIWGTLSIMRSMKS CLLLDNYMETILNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSSDYLHL NPDNFAIQLEKGGKFTVRGKPTLEDLEQFSEKFYCSCYSTLSCKEKADVK DTDAVDVCIADGVCIDAFLKPPMETEEPQIFYNASPSTLSATMFIVSILF LIISSVASL
Molecular Weight 84 kDa
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed