Recombinant Human SP17 Protein

Beta LifeScience SKU/CAT #: BLA-8412P
Recombinant Human SP17 Protein

Recombinant Human SP17 Protein

Beta LifeScience SKU/CAT #: BLA-8412P
Catalog No.: BLA-8412P

Product Overview

Host Species Human
Synonym Band 34 Cancer/testis antigen 22 CT22 SP17 1 Sp17-1 SP17_HUMAN SPA17 Sperm autoantigenic protein 17 Sperm protein 17 Sperm surface protein Sp17
Description Recombinant Human SP17 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKR EKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETS VTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEEN K
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed