Recombinant Human SP100 Protein

Beta LifeScience SKU/CAT #: BLA-8411P
Recombinant Human SP100 Protein

Recombinant Human SP100 Protein

Beta LifeScience SKU/CAT #: BLA-8411P
Catalog No.: BLA-8411P

Product Overview

Host Species Human
Accession P23497
Synonym DKFZp686E07254 FLJ00340 FLJ34579 Lysp100b Nuclear antigen Sp100 Nuclear autoantigen Sp 100 Nuclear autoantigen Sp-100 Nuclear autoantigen Sp100 Nuclear dot associated Sp100 protein Nuclear dot-associated Sp100 protein SP 100 SP100 SP100 HMG nuclear autoantigen SP100 nuclear antigen SP100_HUMAN Speckled 100 kDa
Description Recombinant Human SP100 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLY DIVFKHFKRNKVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRNLV PVQRVVYNVLSELEKTFNLPVLEALFSDVNMQEYPDLIHIYKGFENVIHD KLPLQESEEEEREERSGLQLSLEQGTGENSFRSLTWPPSGSPSHAGTTPP ENGLSEHPCETEQINAKRKDTTSDKDDSLGSQQTNEQCAQKAEPTESCEQ IAVQVNNGDAGREMPCPLPCDEESPEAELHNHGIQINSCSVRLVDIKKEK PFSNSKVECQAQARTHHNQASDIIVISSEDSEGSTDVDEPLEVFISAPRS EPVINNDNPLESNDEKEGQEATCSRPQIVPEPMDFRKLSTFRESFKKRVI GQDHDFSESSEEEAPAEASSGALRSKHGEKAPMTSRSTSTWRIPSRKRRF SSSDFSDLSNGEELQETCSSSLRRGSGKED
Molecular Weight 79 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed