Recombinant Human SOX2 Protein

Beta LifeScience SKU/CAT #: BLA-8404P
Recombinant Human SOX2 Protein

Recombinant Human SOX2 Protein

Beta LifeScience SKU/CAT #: BLA-8404P
Catalog No.: BLA-8404P

Product Overview

Host Species Human
Accession P48431
Synonym ANOP3 cb236 Delta EF2a lcc MCOPS3 MGC148683 MGC2413 RGD1565646 Sex determining region Y box 2 SOX 2 Sox2 SOX2_HUMAN SRY (sex determining region Y) box 2 SRY box containing gene 2 SRY related HMG box 2 SRY related HMG box gene 2 SRY-box 2 Transcription factor SOX 2 Transcription factor SOX-2 ysb
Description Recombinant Human SOX2 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMV WSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRAL HMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLG AGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRY DVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASS SPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQS GPVPGTAINGTLPLSHMESGGGGSPGRRRRRRRRRRR
Molecular Weight 37 kDa
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity The in vitro function was tested using specific DNA binding assays. 11R proteins were reported to successfully generate induced pluripotent stem (iPS) cells from OG2 MEFs.
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle.
Recently viewed