Recombinant Human Sex Hormone Binding Globulin/SHBG Protein

Beta LifeScience SKU/CAT #: BLA-9047P
Recombinant Human Sex Hormone Binding Globulin/SHBG Protein

Recombinant Human Sex Hormone Binding Globulin/SHBG Protein

Beta LifeScience SKU/CAT #: BLA-9047P
Catalog No.: BLA-9047P

Product Overview

Host Species Human
Synonym ABP Androgen binding protein SBP Sex hormone-binding globulin Sex steroid binding protein Sex steroid-binding protein SHBG SHBG_HUMAN TeBG Testis specific androgen binding protein Testis-specific androgen-binding protein Testosterone binding beta globulin Testosterone estradiol binding globulin Testosterone estrogen binding globulin Testosterone-estradiol-binding globulin Testosterone-estrogen-binding globulin
Description Recombinant Human Sex Hormone Binding Globulin/SHBG Protein was expressed in Wheat germ. It is a Protein fragment
Source Wheat germ
AA Sequence DPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTN PKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDS
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed