Recombinant Human Sex Hormone Binding Globulin/SHBG Protein
Beta LifeScience
SKU/CAT #: BLA-9047P
Recombinant Human Sex Hormone Binding Globulin/SHBG Protein
Beta LifeScience
SKU/CAT #: BLA-9047P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | ABP Androgen binding protein SBP Sex hormone-binding globulin Sex steroid binding protein Sex steroid-binding protein SHBG SHBG_HUMAN TeBG Testis specific androgen binding protein Testis-specific androgen-binding protein Testosterone binding beta globulin Testosterone estradiol binding globulin Testosterone estrogen binding globulin Testosterone-estradiol-binding globulin Testosterone-estrogen-binding globulin |
Description | Recombinant Human Sex Hormone Binding Globulin/SHBG Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | DPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTN PKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDS |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |