Recombinant Human SEMA4C/SEMAI Protein
Beta LifeScience
SKU/CAT #: BLA-8077P
Recombinant Human SEMA4C/SEMAI Protein
Beta LifeScience
SKU/CAT #: BLA-8077P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Synonym | KIAA1739 M-SEMA-F S4c SEM4C_HUMAN Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4C SEMA4C SEMACL1 SEMAF SEMAI Semaphorin-4C UNQ5855/PRO34487 |
Description | Recombinant Human SEMA4C/SEMAI Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | LLIQHVMTSDTSGICNLRGSKKVRPTPKNITVVAGTDLVLPCHLSSNLAH ARWTFGGRDLPAEQPGSFLYDARLQALVVMAAQPRHAGAYHCFSEEQGAR |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |