Recombinant Human SelM Protein
Beta LifeScience
SKU/CAT #: BLA-8072P
Recombinant Human SelM Protein
Beta LifeScience
SKU/CAT #: BLA-8072P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q8WWX9 |
Synonym | Selenoprotein M Selenoprotein SelM SELM SelM protein SEPM |
Description | Recombinant Human SelM Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKAFVTQDIPFYHNLVMK HLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQ VPPEYVWAPAKPPEETSDHADL |
Molecular Weight | 14 kDa |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | May function as a thiol-disulfide oxidoreductase that participates in disulfide bond formation. |
Subcellular Location | Cytoplasm, perinuclear region. Endoplasmic reticulum. Golgi apparatus. Note=Localized to perinuclear structures corresponding to Golgi and endoplasmic reticulum. |
Protein Families | Selenoprotein M/F family |
Database References | |
Tissue Specificity | Widely expressed. |
Gene Functions References
- results evidence for the first time an increase of SELM expression in HCC liver tissues, and its gradual expression raise associated with an increased malignancy grade. PMID: 25578973
- As Gal-1 plays important roles in preventing neurodegeneration and promoting neuroprotection in the brain, the interaction between SelM' and Gal-1 displays a new direction for studying the biological function of SelM in the human brain. PMID: 24284396
- The aim of this study has been to analyze the structure-function relationships of SelM. PMID: 24332979