Recombinant Human SelM Protein
Beta LifeScience
SKU/CAT #: BLA-8072P
Recombinant Human SelM Protein
Beta LifeScience
SKU/CAT #: BLA-8072P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q8WWX9 |
Synonym | Selenoprotein M Selenoprotein SelM SELM SelM protein SEPM |
Description | Recombinant Human SelM Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKAFVTQDIPFYHNLVMK HLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQ VPPEYVWAPAKPPEETSDHADL |
Molecular Weight | 14 kDa |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |