Recombinant Human SDHD Protein
Beta LifeScience
SKU/CAT #: BLA-8050P
Recombinant Human SDHD Protein
Beta LifeScience
SKU/CAT #: BLA-8050P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | O14521 |
Synonym | CBT1 CII 4 CII-4 CII4 CWS3 CybS DHSD_HUMAN mitochondrial OTTHUMP00000234720 OTTHUMP00000234721 OTTHUMP00000234722 OTTHUMP00000234723 OTTHUMP00000234724 OTTHUMP00000234725 OTTHUMP00000234726 PGL PGL1 QPs3 SDH4 sdhD Succinate dehydrogenase [ubiquinone] cytochrome b small subunit Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial Succinate dehydrogenase complex subunit D Succinate dehydrogenase complex, subunit D, integral membrane protein Succinate dehydrogenase ubiquinone cytochrome B small subunit Succinate ubiquinone oxidoreductase cytochrome b small subunit Succinate ubiquinone reductase membrane anchor subunit Succinate-ubiquinone oxidoreductase cytochrome b small subunit Succinate-ubiquinone reductase membrane anchor subunit |
Description | Recombinant Human SDHD Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MAVLWRLSAVCGALGGRALLLRTPVVRPAHISAFLQDRPIPEWCGVQHIH LSPSHHSGSKAASLHWTSERVVSVLLLGLLPAAYLNPCSAMDYSLAAALT LHGHWGLGQVVTDYVHGDALQKAAKAGLLALSALTFAGLCYFNYHDVGIC KAVAMLWKL |
Molecular Weight | 44 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |