Recombinant Human SCGB1D1 Protein (BSA and azide free)
Beta LifeScience
SKU/CAT #: BLA-8022P
Recombinant Human SCGB1D1 Protein (BSA and azide free)
Beta LifeScience
SKU/CAT #: BLA-8022P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | O95968 |
Synonym | LIPA LIPHA lipophilin A (uteroglobin family member) Lipophilin-A LPNA prostatein-like lipophilin A secretoglobin, family 1D, member 1 |
Description | Recombinant Human SCGB1D1 Protein (BSA and azide free) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | VVCQALGSEITGFLLAGKPVFKFQLAKFKAPLEAVAAKMEVKKCVDTMAY EKRVLITKTLGKIAEKCDR |
Molecular Weight | 9 kDa including tags |
Purity | Greater than 95% Densitometry. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at Room Temperature. Store at +4°C short term (1-2 weeks). Store at -80°C. Avoid freeze / thaw cycle. |