Recombinant Human SC35 Protein
Beta LifeScience
SKU/CAT #: BLA-8016P
Recombinant Human SC35 Protein
Beta LifeScience
SKU/CAT #: BLA-8016P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | 35 kDa arginine/serine-rich 2 PR264 Protein PR264 SC 35 SC-35 SC35 Serine/arginine-rich splicing factor 2 SFRS 2 SFRS2 SFRS2A Splicing component Splicing component 35 kDa Splicing factor Splicing factor arginine/serine rich 2 Splicing factor SC35 Splicing speckle Splicing speckles SR splicing factor 2 SRp30b SRSF2 SRSF2_HUMAN |
Description | Recombinant Human SC35 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRY TKESRGFAFVRFHDKRDAEDAMDAMDGADPGVGAVPGLAADLATAARSLG PALVLDLGRPPSPDPHEGPSPSPRRSPDLVRGPGPGLGPGVLPQCPRGNP NPGRDRRVPPSLLKRKERCPLKKMLRSPV |
Molecular Weight | 45 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |