Recombinant Human SAMSN1 Protein
Beta LifeScience
SKU/CAT #: BLA-8002P
Recombinant Human SAMSN1 Protein
Beta LifeScience
SKU/CAT #: BLA-8002P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q9NSI8 |
Synonym | HACS1 Hematopoietic adapter containing SH3 and sterile motif (SAM) domains 1 Hematopoietic adapter containing SH3 and sterile alpha motif (SAM) domains 1 Hematopoietic adaptor containing SH3 and SAM domains 1 Nash1 Nuclear localization signals SAM and SH3 domain containing 1 SAM and SH3 domain containing 2 SAM domain SAM domain containing protein SAMSN 1 SAM domain SH3 domain and nuclear localisation signals 1 SAM domain SH3 domain and nuclear localization signals 1 SAM domain, SH3 domain and nuclear localization signals protein 1 SAM domain-containing protein SAMSN-1 SAMN1_HUMAN SAMSN 1 Samsn1 SASH2 SH3 domain and nuclear localisation signals 1 SH3 domain and nuclear localization signals protein 1 SH3 SAM adaptor protein SH3-SAM adaptor protein SH3D6B SLy2 Src homology domain 3 (SH3) containing adapter protein SH3 lymphocyte protein 2 |
Description | Recombinant Human SAMSN1 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMLKRKPSNVSEKEKHQKPKRSSSFGNF DRFRNNSLSKPDDSTEAHEGDPTNGSGEQSKTSNNGGGLGKKMRAISWTM KKKVGKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSLKASDSMD SLYSGQSSSS GITSCSDGTSNRDSFRLDDDGPYSGPFCGRARVHTDFTPSPYDTDSLKIK KGDIIDIICKTPMGMWTGMLNNKVGNFKFIYVDVISEEEAAPKKIKANRR SNSKKSKTLQEFLERIHLQEYTSTLLLNGYETLEDLKDIK ESHLIELNIE NPDDRRRLLS AAENFLEEEIIQEQENEPEPLSLSSDISLNKSQLDDCPRDSGCYISSGNS DNGKEDLESENLSDMVHKIIITEPSD |
Molecular Weight | 44 kDa including tags |
Purity | Greater than 80% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |