Recombinant Human Sall4 Protein
Beta LifeScience
SKU/CAT #: BLA-7999P
Recombinant Human Sall4 Protein
Beta LifeScience
SKU/CAT #: BLA-7999P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Synonym | AA407717 AL022809 AW536104 C330011P20Rik C78083 C78563 dJ1112F19.1 DRRS HSAL4 Sal like 4 Sal like 4 (Drosophila) Sal like Protein 4 Sal-like protein 4 Sall4 SALL4_HUMAN Spalt like transcription factor 4 Tex20 Zinc finger protein 797 Zinc finger protein SALL4 ZNF797 |
Description | Recombinant Human Sall4 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLG ATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |