Recombinant Human SALL2 Protein
Beta LifeScience
SKU/CAT #: BLA-7998P
Recombinant Human SALL2 Protein
Beta LifeScience
SKU/CAT #: BLA-7998P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q9Y467 |
Synonym | AI225809 AW559097 FLJ10414 FLJ55746 HSAL2 KIAA0360 mKIAA0360 Msal-2 p150 Sal2 p150(Sal2) Sal like protein 2 Sal-2 Sal-like 2 Sal-like 2 (Drosophila) Spalt-like protein 2 Zinc finger protein SALL2 Zinc finger protein Spalt-2 ZNF795 |
Description | Recombinant Human SALL2 Protein was expressed in Mammalian. It is a Protein fragment |
Source | Mammalian |
AA Sequence | MSRRKQRKPQQLISDCEGPSASENGDASEEDHPQVCAKCCAQFTDPTEFL AHQNACSTDPPVMVIIGGQENPNNSSASSEPRPEGHNNPQVMDTEHSNPP DSGSSVPTDPTWGPERRGEESPGHFLVAATGTAAGGGGGLILASPKLGAT PLPPESTPAPPPPPPPPPPPGVGSGHLNIPLILEELRVLQQRQIHQMQ |
Molecular Weight | 25 kDa including tags |
Purity | >90% by SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |