Recombinant Human SAA3 Protein

Name: Recombinant Human SAA3 Protein
Brand: Beta LifeScience
SKU: BLA-7989P
Availability: InStock

Collections: Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	P04918
Description	Recombinant Human SAA3 Protein was expressed in Yeast. It is a Full length protein
Source	Yeast
AA Sequence	RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGG AWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLP KRY
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at Room Temperature. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Major acute phase reactant. Apolipoprotein of the HDL complex.
Subcellular Location	Secreted.
Protein Families	SAA family
Database References	KEGG: mmu:20210 STRING: 10090.ENSMUSP00000006956 UniGene: Mm.14277
Tissue Specificity	Found in various tissues.

Gene Functions References

High SAA3 expression in the stromal component is associated with pancreatic tumors. PMID: 29351990
This study suggests that the level of expression of the Saa3 gene could be utilized for the number of infiltrated macrophages in obese adipose tissue. PMID: 27929048
BMDC lacking SAA3 demonstrate an impaired endotoxin tolerance response and inhibited responses to retinoic acid. Our findings indicate that endogenous SAA3 modulates metabolic and immune homeostasis PMID: 29390039
The induction of Saa3 by PTH may explain the suppression of bone formation when PTH is applied continuously and may be a new therapeutic target for osteoporosis. PMID: 26703472
results also suggest that Saa3 influences liver-specific SAA1/2 expression, and that SAA3 could play a larger role in the acute phase response than previously thought PMID: 25251243
Expression of Saa3 in osteoblasts positively correlates with increased cellular maturation toward the osteocyte phenotype. PMID: 25491310
Serum amyloid A is a retinol binding protein that transports retinol during bacterial infection. PMID: 25073702
these data suggest a novel mechanism by which Mo MDSCs mediate inflammation through SAA3-TLR2 signaling and thus exacerbate cancer progression by a STAT3-dependent mechanism. PMID: 24659444
Hypoxia leads to a substantial increase in SAA3 mRNA and protein level, apparently in a time-dependent manner (threefold in 48 h), in fully differentiated 3T3-L1, followed by reestablishment of gene expression to basal levels after 24 h of reoxygenation. PMID: 23605472
Using various synthetic peptide fragments, it was shown that SAA3 directly binds MD-2 and activates the MyD88-dependent TLR4/MD-2 pathway, induced IL-6 and TNF-alpha, and recruited CD11b(+)Gr-1(+) cells to the lung. PMID: 23858030
HSV-1 induces and activate TLR2 and TLR4 receptors directly through interaction of astrocytes with the pathogen and also indirectly by endogenous ligands produced locally, such as serum amyloid A, potentiating the neuroinflammatory response. PMID: 22622619
Saa3 is expressed in the lungs of mice exposed to several mixed T helper (Th) type 2/Th17-polarizing allergic sensitization regimen and is implicated in the pathogenesis of experimental allergic asthma. PMID: 21622869
cAMP in combination with TNF specifically induced C/EBPbeta protein, leading to enhanced SAA3 expression but requiring NF-kappaB in mouse granulose cells. The data indicate SAA may play a role in events occurring during the ovulation process. PMID: 20444945
A 210-bp fragment of the mouse SAA3 promoter when placed in front of the LacZ gene was sufficient to confer basal and inflammation-induced reporter gene expression. PMID: 11791617
tumor necrosis factor-alpha likely increased serum amyloid A 3 promoter activity and protein by activating nuclear factor-kappaB signaling via tumor necrosis factor receptor 1 in mouse granulosa cells PMID: 14749357
Adipocyte hypertrophy leads to increased production of SAA and hyaluronan, which srecruit and retains monocytes, thereby leading to local inflammation in adipose tissue. PMID: 17563062
These data show a potent upregulation of SAA3 by IL-1beta. PMID: 18452164
In adipose tissue Saa3 was the predominant isoform and the earliest inflammatory marker induced, suggesting it is important for initiation of adipose tissue inflammation. PMID: 18584041
Results indicate that the expression of SAA3 in adipose tissue is upregulated by obesity, but it does not contribute to the circulating pool of SAA in mice. PMID: 19286646
serum amyloid A3 (SAA3) is regulated in mouse colonic epithelium and adipose tissue by the intestinal microbiota PMID: 19513118

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.