Recombinant Human S6K1 Protein (Tagged-His Tag)
Beta LifeScience
SKU/CAT #: BLA-7988P
Recombinant Human S6K1 Protein (Tagged-His Tag)
Beta LifeScience
SKU/CAT #: BLA-7988P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P23443 |
Synonym | 70 kDa ribosomal protein S6 kinase 1 KS6B1_HUMAN p70 alpha P70 beta 1 p70 ribosomal S6 kinase alpha p70 ribosomal S6 kinase beta 1 P70 S6 Kinase p70 S6 kinase alpha p70 S6 kinase, alpha 1 p70 S6 kinase, alpha 2 p70 S6K p70 S6K-alpha p70 S6KA p70(S6K) alpha p70(S6K)-alpha p70-alpha p70-S6K p70-S6K 1 P70S6K P70S6K1 p70S6Kb PS6K Ribosomal protein S6 kinase 70kDa polypeptide 1 Ribosomal protein S6 kinase beta 1 Ribosomal protein S6 kinase beta-1 Ribosomal protein S6 kinase I RPS6KB1 S6K S6K-beta-1 S6K1 Serine/threonine kinase 14 alpha Serine/threonine-protein kinase 14A STK14A |
Description | Recombinant Human S6K1 Protein (Tagged-His Tag) was expressed in Baculovirus infected Sf9 cells. It is a Full length protein |
Source | Baculovirus infected Sf9 cells |
AA Sequence | MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQL NESMDHGGVGPYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKG GYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEV KHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLA EISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVT HTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHP FFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTL SESANQVFLGFTYVAPSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVK FSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQ PNSGPYKKQAFPMISKRPEHLRMNL |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The specific activity was determined to be89nmol/min/mg in akinase assay usingS6K synthetic peptidesubstrate. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |