Recombinant Human S100A5 Protein

Beta LifeScience SKU/CAT #: BLA-8843P
Recombinant Human S100A5 Protein

Recombinant Human S100A5 Protein

Beta LifeScience SKU/CAT #: BLA-8843P
Catalog No.: BLA-8843P

Product Overview

Host Species Human
Accession P33763
Synonym Protein S-100D Protein S100-A5 S100 calcium binding protein A5 S100 calcium-binding protein A5 S100a5 S100D S100D9 S10A5_HUMAN
Description Recombinant Human S100A5 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMETPLEKALTTMVTTFHKYSGREGSKLTLS RKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLC MAYNDFFLEDNK
Molecular Weight 13 kDa including tags
Purity Greater than 90% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed