Recombinant Human S100A10 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-8828P
Recombinant Human S100A10 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-8828P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P60903 |
Synonym | 42C AA409961 AL024248 Annexin II ligand Annexin II ligand, calpactin I, light polypeptide Annexin II tetramer (AIIt) p11 subunit Annexin II, light chain ANX2L ANX2LG Ca[1] CAL12 CAL1L Calpactin I light chain Calpactin I, p11 subunit Calpactin-1 light chain Cellular ligand of annexin II CLP11 GP11 MGC111133 Nerve growth factor-induced protein 42C OTTHUMP00000015269 OTTHUMP00000015270 p10 p10 protein p11 Protein S100 A10 Protein S100-A10 S100 calcium binding protein A10 S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)) S100 calcium binding protein A10 (calpactin) S100 calcium-binding protein A10 S100a10 S10AA_HUMAN |
Description | Recombinant Human S100A10 Protein (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPL AVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK |
Molecular Weight | 12 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase. |
Protein Families | S-100 family |
Database References |
Gene Functions References
- study has localised AnxA2/S100A10 complexes to key anatomical locations in the placenta and suggests a role for this complex in amniotic epithelium, trophoblasts and syncytium, in addition to its well-known roles in endothelial cells PMID: 30143909
- The overexpression of ANXA2 in U937 cells transfected with full-length ANXA2 cDNA was associated with increased S100A10 subunit, although S100A10 transcripts remained constitutive. PML/RARalpha fusion protein transactivated the ANXA2 promoter to upregulate ANXA2 and accumulate S100A10. PMID: 28687976
- these studies define a new paradigm for plasminogen activation by the plasminogen receptor, S100A10 PMID: 28382372
- These findings provides evidence that gene-gene interactions between p11, tPA and BDNF are all associated with post stroke depression. PMID: 29028593
- Given that inflammation plays a role in both Parkinson's disease (PD)and depression, it is intriguing that peripheral p11 levels are altered in immune cells in both conditions. Our data provide insight into the pathological alterations occurring centrally and peripherally in PD. Moreover, if replicated in other cohorts, p11 could be an easily accessible biomarker PMID: 28137881
- The S100A10 and S100B genes, which are located on different chromosomes, encode specialized calcium-binding proteins. These data support a role for calcium homeostasis in individuals with Cannabis Dependence and high risk sex behaviours. PMID: 28418321
- These findings identify S100A10 as a player in endometrial receptivity acquisition. PMID: 26760977
- Findings indicate that Munc13-4 supports acute WPB exocytosis by tethering WPBs to the plasma membrane via AnxA2-S100A10. PMID: 28450451
- Here, the authors demonstrate that S100A10 is required for ULK1 localization to autophagosome formation sites. Silencing of S100A10 reduces IFN-gamma-induced autophagosome formation. PMID: 27871932
- p11 might be a potential regulator on 5-HTR1b and 5-HTR4 as well as a predictor of or a therapeutic target for IFN-alpha-induced depression. PMID: 26821757
- annexin A2 and S100A10 expressions are powerful predictors of serous ovarian cancer outcome. PMID: 26925708
- These data show that disruption of ANX2/p11 interaction results in reduced ALL cell adhesion to osteoblasts, increased ALL cell sensitization to chemotherapy, and suppression of ALL cell homing and engraftment. PMID: 26465153
- Annexin A2 complexes with S100 proteins: structure, function and pharmacological manipulation PMID: 25303710
- Overexpression of miR-590-5P reduced the activity of luciferase expressed by a vector bearing the 3' untranslated region of S100A10 mRNA. Ectopic miR-590-5P overexpression mediated by lentiviral infection decreased expression of S100A10. PMID: 23598417
- TPH1 gene polymorphisms and S100A10 expression, which correlate with 5-HT signaling were associated with ramosetron effectiveness in IBS-D, and may possibly lead to prospective identification of the resistance to treatment. PMID: 25428414
- Authors show here that AnxA2, p11 and AHNAK are required for type 3 secretion system-mediated Salmonella invasion of cultured epithelial cells. PMID: 23931152
- Data suggest a role for S100A10 as a prognostic marker and potential therapeutic target in colorectal cancer. PMID: 23828264
- an annexin A2-S100A10 molecular bridge participates in cell-cell interactions, revealing a hitherto unexplored function of this protein interaction PMID: 23994525
- complex formation of AnxA2 with S100A10 is a central regulatory mechanism in the acute release of VWF in response to cAMP-elevating agonists PMID: 23757730
- Suggest annexin A10 as potential marker of sessile serrated adenoma/polyps. PMID: 23595865
- extracellular C-1-P, acting through the extracellular annexin a2-p11 heterotetrameric protein, can mediate vascular endothelial cell invasion. PMID: 23696646
- Annexin A2 and S100A10 regulate human papillomavirus type 16 entry and intracellular trafficking in human keratinocytes. PMID: 23637395
- results demonstrate the crucial role of S100A10 in actin dynamics promoting cell spreading via Rac1 activation PMID: 23129259
- Binding of AHNAK to the surface of AnxA2 is governed by several hydrophobic interactions between side chains of AHNAK and pockets on S100A10. PMID: 23275167
- N-terminal acetylation of AnxA2 is required for S100A10 binding PMID: 23091277
- The AHNAK peptide adopts a coil conformation that arches across the heterotetramer contacting both annexin A2 and S100A10 protomers with tight affinity. PMID: 22940583
- Human chondrocytes with downregulated S100A10 showed significantly decreased production of inflammatory cytokines such as tumor necrosis factor-alpha, IL-1beta and IL-10; hence, S100A10 might be considered a potential target for anti-inflammatory treatment PMID: 22797859
- Annexin A2 anchors S100A10 to the cell surface and, in doing so, allows S100A10 to play a prominent role in the activation of plasminogen in angiogenesis and oncogenesis. PMID: 22830395
- annexin A2 heterotetramer contributes to HPV16 internalization and infection of epithelial cells and this interaction is dependent on the presence of the L2 minor capsid protein PMID: 22927980
- COX7A2, TAGLN2 and S100-A10 as novel prognostic markers in Barrett's adenocarcinoma. PMID: 22365974
- the overexpression of thioredoxin,S100-A10 and S100-A6 specifically distinguished metastatic from non-metastatic tumors. PMID: 21938494
- Interferon-gamma stimulates p11-dependent surface expression of annexin A2 in lung epithelial cells to enhance phagocytosis. PMID: 21928315
- This study demonstrates that PBMC p11 mRNA expression is associated with neural activation in the brain of BD patients and warrants a larger translational study to determine its clinical utility. PMID: 21722919
- Both the annexin A2 and p11 subunits of calpactin I coimmunoprecipitate with human papillomavirus type 16 E5 in COS cells and in human epithelial cell lines, and an intact E5 C terminus is required for binding. PMID: 21849434
- Understanding the chromatin remodeling involved in the glucocorticoid-mediated increase of p11 expression by stress may clarify stress-induced over-expression of p PMID: 21367534
- The results of this study suggested that PBMC p11 mRNA levels may be a potential adjunctive biomarker for the assessment of suicide risk in mental disorders and warrants a larger translational study to determine its clinical utility. PMID: 20863517
- DLC1 binding to S100A10 did not affect DLC1's RhoGAP activity, but it decreased the steady-state level of S100A10 expression. PMID: 21372205
- S100A10 plays a crucial role in the generation of plasmin leading to fibrinolysis, thus providing a link to the clinical hemorrhagic phenotype of acute promyelocytic leukemia PMID: 21310922
- The present study represents a first attempt to systematically understand the molecular basis for the calcium-insensitive open conformation of S100A10. PMID: 21269277
- CFTR function by annexin A2-S100A10 complex has roles in health and disease [review] PMID: 20093721
- First insights of S100A10 function as a regulator of the filamentous actin network. PMID: 20100475
- These results suggest that epidermal growth factor treatment increased p11 bound to cPLA(2) may lead to the late suppression of AA release induced by EGF. PMID: 12163506
- p11 interacts specifically with the TASK-1 K+ channel. PMID: 12198146
- Calpactin light chain binds to bluetongue virus NS3 protein PMID: 12235365
- IFN-gamma-stimulated p11 expression may serve a counterregulatory role in human epithelial cells PMID: 12645529
- analysis of S100A10 interaction with tissue plasminogen activator, plasminogen, and plasmin PMID: 12730231
- annexin 2/S100A10 complex functions in the intracellular positioning of recycling endosomes and that both subunits are required for this activity PMID: 13679511
- Temperature stress-induced annexin 2 translocation is dependent on both expression of protein p11 tyrosine phosphorylation of annexin 2 PMID: 15302870
- S100A10 and annexin A2 play an important role in plasmin regulation and in cancer cell invasiveness and metastasis [review] PMID: 15574370
- complex with annexin II is a substrate of thioredoxin PMID: 15849182