Recombinant Human S100A10 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-8828P
Recombinant Human S100A10 Protein (His tag)

Recombinant Human S100A10 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-8828P
Catalog No.: BLA-8828P

Product Overview

Host Species Human
Accession P60903
Synonym 42C AA409961 AL024248 Annexin II ligand Annexin II ligand, calpactin I, light polypeptide Annexin II tetramer (AIIt) p11 subunit Annexin II, light chain ANX2L ANX2LG Ca[1] CAL12 CAL1L Calpactin I light chain Calpactin I, p11 subunit Calpactin-1 light chain Cellular ligand of annexin II CLP11 GP11 MGC111133 Nerve growth factor-induced protein 42C OTTHUMP00000015269 OTTHUMP00000015270 p10 p10 protein p11 Protein S100 A10 Protein S100-A10 S100 calcium binding protein A10 S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)) S100 calcium binding protein A10 (calpactin) S100 calcium-binding protein A10 S100a10 S10AA_HUMAN
Description Recombinant Human S100A10 Protein (His tag) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPL AVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
Molecular Weight 12 kDa including tags
Purity >95% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed