Recombinant Human S100A10 Protein (His tag)

Name: Recombinant Human S100A10 Protein (His tag)
Brand: Beta LifeScience
SKU: BLA-8828P
Availability: InStock

Collections: Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	P60903
Synonym	42C AA409961 AL024248 Annexin II ligand Annexin II ligand, calpactin I, light polypeptide Annexin II tetramer (AIIt) p11 subunit Annexin II, light chain ANX2L ANX2LG Ca[1] CAL12 CAL1L Calpactin I light chain Calpactin I, p11 subunit Calpactin-1 light chain Cellular ligand of annexin II CLP11 GP11 MGC111133 Nerve growth factor-induced protein 42C OTTHUMP00000015269 OTTHUMP00000015270 p10 p10 protein p11 Protein S100 A10 Protein S100-A10 S100 calcium binding protein A10 S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)) S100 calcium binding protein A10 (calpactin) S100 calcium-binding protein A10 S100a10 S10AA_HUMAN
Description	Recombinant Human S100A10 Protein (His tag) was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPL AVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
Molecular Weight	12 kDa including tags
Purity	>95% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase.
Protein Families	S-100 family
Database References	HGNC: 10487 OMIM: 114085 KEGG: hsa:6281 STRING: 9606.ENSP00000357799 UniGene: Hs.143873

Gene Functions References

study has localised AnxA2/S100A10 complexes to key anatomical locations in the placenta and suggests a role for this complex in amniotic epithelium, trophoblasts and syncytium, in addition to its well-known roles in endothelial cells PMID: 30143909
The overexpression of ANXA2 in U937 cells transfected with full-length ANXA2 cDNA was associated with increased S100A10 subunit, although S100A10 transcripts remained constitutive. PML/RARalpha fusion protein transactivated the ANXA2 promoter to upregulate ANXA2 and accumulate S100A10. PMID: 28687976
these studies define a new paradigm for plasminogen activation by the plasminogen receptor, S100A10 PMID: 28382372
These findings provides evidence that gene-gene interactions between p11, tPA and BDNF are all associated with post stroke depression. PMID: 29028593
Given that inflammation plays a role in both Parkinson's disease (PD)and depression, it is intriguing that peripheral p11 levels are altered in immune cells in both conditions. Our data provide insight into the pathological alterations occurring centrally and peripherally in PD. Moreover, if replicated in other cohorts, p11 could be an easily accessible biomarker PMID: 28137881
The S100A10 and S100B genes, which are located on different chromosomes, encode specialized calcium-binding proteins. These data support a role for calcium homeostasis in individuals with Cannabis Dependence and high risk sex behaviours. PMID: 28418321
These findings identify S100A10 as a player in endometrial receptivity acquisition. PMID: 26760977
Findings indicate that Munc13-4 supports acute WPB exocytosis by tethering WPBs to the plasma membrane via AnxA2-S100A10. PMID: 28450451
Here, the authors demonstrate that S100A10 is required for ULK1 localization to autophagosome formation sites. Silencing of S100A10 reduces IFN-gamma-induced autophagosome formation. PMID: 27871932
p11 might be a potential regulator on 5-HTR1b and 5-HTR4 as well as a predictor of or a therapeutic target for IFN-alpha-induced depression. PMID: 26821757
annexin A2 and S100A10 expressions are powerful predictors of serous ovarian cancer outcome. PMID: 26925708
These data show that disruption of ANX2/p11 interaction results in reduced ALL cell adhesion to osteoblasts, increased ALL cell sensitization to chemotherapy, and suppression of ALL cell homing and engraftment. PMID: 26465153
Annexin A2 complexes with S100 proteins: structure, function and pharmacological manipulation PMID: 25303710
Overexpression of miR-590-5P reduced the activity of luciferase expressed by a vector bearing the 3' untranslated region of S100A10 mRNA. Ectopic miR-590-5P overexpression mediated by lentiviral infection decreased expression of S100A10. PMID: 23598417
TPH1 gene polymorphisms and S100A10 expression, which correlate with 5-HT signaling were associated with ramosetron effectiveness in IBS-D, and may possibly lead to prospective identification of the resistance to treatment. PMID: 25428414
Authors show here that AnxA2, p11 and AHNAK are required for type 3 secretion system-mediated Salmonella invasion of cultured epithelial cells. PMID: 23931152
Data suggest a role for S100A10 as a prognostic marker and potential therapeutic target in colorectal cancer. PMID: 23828264
an annexin A2-S100A10 molecular bridge participates in cell-cell interactions, revealing a hitherto unexplored function of this protein interaction PMID: 23994525
complex formation of AnxA2 with S100A10 is a central regulatory mechanism in the acute release of VWF in response to cAMP-elevating agonists PMID: 23757730
Suggest annexin A10 as potential marker of sessile serrated adenoma/polyps. PMID: 23595865
extracellular C-1-P, acting through the extracellular annexin a2-p11 heterotetrameric protein, can mediate vascular endothelial cell invasion. PMID: 23696646
Annexin A2 and S100A10 regulate human papillomavirus type 16 entry and intracellular trafficking in human keratinocytes. PMID: 23637395
results demonstrate the crucial role of S100A10 in actin dynamics promoting cell spreading via Rac1 activation PMID: 23129259
Binding of AHNAK to the surface of AnxA2 is governed by several hydrophobic interactions between side chains of AHNAK and pockets on S100A10. PMID: 23275167
N-terminal acetylation of AnxA2 is required for S100A10 binding PMID: 23091277
The AHNAK peptide adopts a coil conformation that arches across the heterotetramer contacting both annexin A2 and S100A10 protomers with tight affinity. PMID: 22940583
Human chondrocytes with downregulated S100A10 showed significantly decreased production of inflammatory cytokines such as tumor necrosis factor-alpha, IL-1beta and IL-10; hence, S100A10 might be considered a potential target for anti-inflammatory treatment PMID: 22797859
Annexin A2 anchors S100A10 to the cell surface and, in doing so, allows S100A10 to play a prominent role in the activation of plasminogen in angiogenesis and oncogenesis. PMID: 22830395
annexin A2 heterotetramer contributes to HPV16 internalization and infection of epithelial cells and this interaction is dependent on the presence of the L2 minor capsid protein PMID: 22927980
COX7A2, TAGLN2 and S100-A10 as novel prognostic markers in Barrett's adenocarcinoma. PMID: 22365974
the overexpression of thioredoxin,S100-A10 and S100-A6 specifically distinguished metastatic from non-metastatic tumors. PMID: 21938494
Interferon-gamma stimulates p11-dependent surface expression of annexin A2 in lung epithelial cells to enhance phagocytosis. PMID: 21928315
This study demonstrates that PBMC p11 mRNA expression is associated with neural activation in the brain of BD patients and warrants a larger translational study to determine its clinical utility. PMID: 21722919
Both the annexin A2 and p11 subunits of calpactin I coimmunoprecipitate with human papillomavirus type 16 E5 in COS cells and in human epithelial cell lines, and an intact E5 C terminus is required for binding. PMID: 21849434
Understanding the chromatin remodeling involved in the glucocorticoid-mediated increase of p11 expression by stress may clarify stress-induced over-expression of p PMID: 21367534
The results of this study suggested that PBMC p11 mRNA levels may be a potential adjunctive biomarker for the assessment of suicide risk in mental disorders and warrants a larger translational study to determine its clinical utility. PMID: 20863517
DLC1 binding to S100A10 did not affect DLC1's RhoGAP activity, but it decreased the steady-state level of S100A10 expression. PMID: 21372205
S100A10 plays a crucial role in the generation of plasmin leading to fibrinolysis, thus providing a link to the clinical hemorrhagic phenotype of acute promyelocytic leukemia PMID: 21310922
The present study represents a first attempt to systematically understand the molecular basis for the calcium-insensitive open conformation of S100A10. PMID: 21269277
CFTR function by annexin A2-S100A10 complex has roles in health and disease [review] PMID: 20093721
First insights of S100A10 function as a regulator of the filamentous actin network. PMID: 20100475
These results suggest that epidermal growth factor treatment increased p11 bound to cPLA(2) may lead to the late suppression of AA release induced by EGF. PMID: 12163506
p11 interacts specifically with the TASK-1 K+ channel. PMID: 12198146
Calpactin light chain binds to bluetongue virus NS3 protein PMID: 12235365
IFN-gamma-stimulated p11 expression may serve a counterregulatory role in human epithelial cells PMID: 12645529
analysis of S100A10 interaction with tissue plasminogen activator, plasminogen, and plasmin PMID: 12730231
annexin 2/S100A10 complex functions in the intracellular positioning of recycling endosomes and that both subunits are required for this activity PMID: 13679511
Temperature stress-induced annexin 2 translocation is dependent on both expression of protein p11 tyrosine phosphorylation of annexin 2 PMID: 15302870
S100A10 and annexin A2 play an important role in plasmin regulation and in cancer cell invasiveness and metastasis [review] PMID: 15574370
complex with annexin II is a substrate of thioredoxin PMID: 15849182

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.