Recombinant Human RRM1 Protein
Beta LifeScience
SKU/CAT #: BLA-7938P
Recombinant Human RRM1 Protein
Beta LifeScience
SKU/CAT #: BLA-7938P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Synonym | R1 Ribonucleoside diphosphate reductase large subunit Ribonucleoside diphosphate reductase M1 chain Ribonucleoside diphosphate reductase subunit M1 Ribonucleoside reductase, large subunit Ribonucleoside-diphosphate reductase large subunit Ribonucleoside-diphosphate reductase subunit M1 Ribonucleotide reductase large chain Ribonucleotide reductase large subunit Ribonucleotide reductase M1 Ribonucleotide reductase M1 polypeptide Ribonucleotide reductase R1 subunit Ribonucleotide reductase, M1 subunit RIR 1 RIR1 RIR1_HUMAN RR 1 RR1 RRM 1 RRM1 |
Description | Recombinant Human RRM1 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLL KDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVL KMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTR PAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |