Recombinant Human RPS7 Protein
Beta LifeScience
SKU/CAT #: BLA-7933P
Recombinant Human RPS7 Protein
Beta LifeScience
SKU/CAT #: BLA-7933P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P62081 |
Synonym | 40S ribosomal protein S7 DBA8 Ribosomal protein S7 RPS 7 rps7 RS7_HUMAN S7 |
Description | Recombinant Human RPS7 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSHMFSSSAKIVKPNGEKPDEFESGISQA LLELEMNSDLKAQLRELNITAAKEIEVGGGRKAIIIFVPVPQLKSFQKIQ VRLVRELEKKFSGKHVVFIAQRRILPKPTRKSRTKNKQKRPRSRTLTAVH DAILEDLVFPSEIVGKRIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGV YKKLTGKDVNFEFPEFQL |
Molecular Weight | 25 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |