Recombinant Human RPP30 Protein
Beta LifeScience
SKU/CAT #: BLA-7915P
Recombinant Human RPP30 Protein
Beta LifeScience
SKU/CAT #: BLA-7915P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P78346 |
Synonym | FLJ38491 Ribonuclease P protein subunit p30 RNase P subunit 2 RNaseP protein p30 RNASEP2 RP11-320F15.1 RPP30 RPP30_HUMAN TSG15 |
Description | Recombinant Human RPP30 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMAVFADLDLRAGSDLKALRGLVETAAH LGYSVVAINHIVDFKEKKQEIEKPVAVSELFTTLPIVQGKSRPIKILTRL TIIVSDPSHCNVLRATSSRARLYDVVAVFPKTEKLFHIACTHLDVDLVCI TVTEKLPFYFKRPPINVAIDRGLAFELVYSPAIKDSTMRRYTISSALNLM QICKGKNVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRA ALLHGETRKTAFGIISTVKKPRPSEGDEDCLPASKKAKCEG |
Molecular Weight | 32 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |