Recombinant Human RPL13 Protein
Beta LifeScience
SKU/CAT #: BLA-7889P
Recombinant Human RPL13 Protein
Beta LifeScience
SKU/CAT #: BLA-7889P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P26373 |
Synonym | 60S ribosomal protein L13 BBC1 Breast basic conserved gene 1 Breast basic conserved protein 1 D16S444E D16S44E FLJ27453 FLJ27454 L13 MGC117342 MGC71373 OK/SW cl.46 OK/SWcl.46 Ribosomal protein L13 RL13_HUMAN rpl13 |
Description | Recombinant Human RPL13 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MAPSRNGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARHIAPRP ASGPIRPIVRCPTVRYHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDP RRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPKKGDSSAEELKLATQL TGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAK EAAEQDVEKKK |
Molecular Weight | 49 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |