Recombinant Human ROR1 Protein
Beta LifeScience
SKU/CAT #: BLA-7866P
Recombinant Human ROR1 Protein
Beta LifeScience
SKU/CAT #: BLA-7866P
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q01973 |
Synonym | dJ537F10.1 Inactive tyrosine protein kinase transmembrane receptor ROR1 MGC99659 Neurotrophic tyrosine kinase Neurotrophic tyrosine kinase receptor related 1 Neurotrophic tyrosine kinase, receptor related 1 NTRKR1 OTTHUMP00000010573 OTTHUMP00000010574 OTTMUSP00000008344 Receptor tyrosine kinase like orphan receptor 1 receptor-related 1 RGD1559469 ROR 1 ROR1 ROR1_HUMAN RP11 24J23.1 Tyrosine kinase like orphan receptor 1 Tyrosine protein kinase transmembrane receptor ROR1 Tyrosine-protein kinase transmembrane receptor ROR1 |
Description | Recombinant Human ROR1 Protein was expressed in CHO cells. It is a Protein fragment |
Source | CHO cells |
AA Sequence | QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHC KVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYF QCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACA RFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCH YAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKL PNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTK SGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDE NFKSDLCDIPACDSKDSKEKNKMEILY |
Molecular Weight | 42 kDa |
Purity | >95% SDS-PAGE.>95 % by HPLC analysis. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |