Recombinant Human RNF186 Protein
Beta LifeScience
SKU/CAT #: BLA-7845P
Recombinant Human RNF186 Protein
Beta LifeScience
SKU/CAT #: BLA-7845P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Synonym | FLJ20225 Ring finger protein 186 RNF 186 RP11 91K11.1 |
Description | Recombinant Human RNF186 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCP RLPKLLACQHAFCAICLKLLLCVQDNTWSITCPLCRKVTAVPGGLICSLR DHEAVVGQLAQPCTEVSLCPQGLVDPADLAAGHPSLVGEDGQDEVSANHV AARRLAAHLLLLALLIILIGPFIYPGVLRWVLTFIIALALLMSTLFCCLP STRGSCWPSSRTLFCREQKHSHISSIA |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |