Recombinant Human RNase 7 Protein
Beta LifeScience
SKU/CAT #: BLA-7833P
Recombinant Human RNase 7 Protein
Beta LifeScience
SKU/CAT #: BLA-7833P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q9H1E1 |
Synonym | EC 3.1.27.- MGC133220 Ribonuclease 7 ribonuclease, RNase A family, 7 RNAS7_HUMAN RNase 7 RNASE7 SAP 2 SAP-2 Skin derived antimicrobial protein 2 Skin-derived antimicrobial protein 2 |
Description | Recombinant Human RNase 7 Protein was expressed in CHO cells. It is a Full length protein |
Source | CHO cells |
AA Sequence | KPKGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSS VAATCQTPKIACKNGDKNCHQSHGAVSLTMCKLTSGKHPNCRYKEKRQNK SYVVACKPPQKKDSQQFHLVPVHLDRVL |
Molecular Weight | 15 kDa |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |