Recombinant Human RNA Helicase A Protein
Beta LifeScience
SKU/CAT #: BLA-7825P
Recombinant Human RNA Helicase A Protein
Beta LifeScience
SKU/CAT #: BLA-7825P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q08211 |
Synonym | ATP dependent RNA helicase A ATP-dependent RNA helicase A DDX 9 DDX9 DEAD/H (Asp Glu Ala Asp/His) box polypeptide 9 DEAD/H box 9 DEAD/H box polypeptide 9 DEAH (Asp Glu Ala His) box polypeptide 9 DEAH box polypeptide 9 DEAH box protein 9 DHX 9 dhx9 DHX9_HUMAN Leukophysin LKP NDH 2 NDH II NDH2 NDHII Nuclear DNA helicase II RHA |
Description | Recombinant Human RNA Helicase A Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | MGDVKNFLYAWCGKRKMTPTYEIRAVGNKNRQKFMCEVQVEGYNYTGMGN STNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP |
Molecular Weight | 36 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |