Recombinant Human RIZ1 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-7823P
Recombinant Human RIZ1 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-7823P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q13029 |
Synonym | GATA-3-binding protein G3B HUMHOXY1 KMT8 Lysine N-methyltransferase 8 MTB-ZF MTE-binding protein PR domain containing 2, with ZNF domain PR domain zinc finger protein 2 PR domain-containing protein 2 PRDM2 PRDM2_HUMAN Retinoblastoma protein binding zinc finger protein Retinoblastoma protein-interacting zinc finger protein Retinoblastoma protein-interacting zinc-finger protein RIZ RIZ1 RIZ2 Zinc finger DNA binding protein Zinc finger protein RIZ |
Description | Recombinant Human RIZ1 Protein (Tagged) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | NQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPIL KGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRY VNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYNGEDNPEIA AAIEEERASARSKRSSPKSRKGKKKSQENKNKGNKIQDIQLKTSEPDFTS A |
Molecular Weight | 50 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at -80°C. |