Recombinant Human RHOC Protein
Beta LifeScience
SKU/CAT #: BLA-7791P
Recombinant Human RHOC Protein
Beta LifeScience
SKU/CAT #: BLA-7791P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P08134 |
Synonym | Aplysia RAS-related homolog 9 ARH 9 ARH9 ARHC H9 MGC1448 MGC61427 Oncogene RHO H9 Ras homolog gene family member C RAS related homolog 9 RHO C Rho cDNA clone 9 Rho related GTP binding protein RhoC Rho-related GTP-binding protein RhoC rhoC RhoC GTPase RHOC_HUMAN RHOH 9 RHOH9 Small GTP binding protein RhoC |
Description | Recombinant Human RHOC Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMAAIRKKLVIVGDGACGKTCLLIVFSKDQF PEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVI LMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRE LAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQ VRKNKRRRGC |
Molecular Weight | 24 kDa including tags |
Purity | >90% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |