Recombinant Human RHOB Protein
Beta LifeScience
SKU/CAT #: BLA-7790P
Recombinant Human RHOB Protein
Beta LifeScience
SKU/CAT #: BLA-7790P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P62745 |
Synonym | Aplysia RAS-related homolog 6 ARH6 ARHB H6 MST081 MSTP081 oncogene RHO H6 ras homolog family member B ras homolog gene family, member B Rho cDNA clone 6 Rho related GTP binding protein RhoB Precursor Rho-related GTP-binding protein RhoB Rhob RHOB_HUMAN RHOH6 |
Description | Recombinant Human RHOB Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMAAIRKKLVVVGDGACGKTCLLIVFSKDEF PEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVI LMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTE LARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQ KRYGSQNGCINCC |
Molecular Weight | 24 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |