Recombinant Human RhoA Protein
Beta LifeScience
SKU/CAT #: BLA-7789P
Recombinant Human RhoA Protein
Beta LifeScience
SKU/CAT #: BLA-7789P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P61586 |
Synonym | Aplysia ras related homolog 12 ARH12 ARHA H 12 H12 Oncogene RHO H12 Ras homolog family member A Ras homolog gene family member A Rho A Rho cDNA clone 12 RHO H12 RHO12 RHOA RHOA_HUMAN RHOH12 Small GTP binding protein Rho A Transforming protein Rho A Transforming protein RhoA |
Description | Recombinant Human RhoA Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDG KQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWT PEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANR IGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGC |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The specific activity of RhoA was 10.9 nmol/min/mg in GPTase-Glo assay. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |