Recombinant Human RGC-32 Protein
Beta LifeScience
SKU/CAT #: BLA-7765P
Recombinant Human RGC-32 Protein
Beta LifeScience
SKU/CAT #: BLA-7765P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Synonym | bA157L14.2 C13orf15 Chromosome 13 open reading frame 15 KIAA0564 MGC87338 regulator of cell cycle Regulator of cell cycle RGCC Response gene to complement 32 Response gene to complement 32 protein RGC 32 RGC-32 RGC32 RGCC RGCC_HUMAN |
Description | Recombinant Human RGC-32 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MKPPAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSD SSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDT KELEAFIADLDKTLASM |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |