Recombinant Human REXO2 Protein
Beta LifeScience
SKU/CAT #: BLA-7757P
Recombinant Human REXO2 Protein
Beta LifeScience
SKU/CAT #: BLA-7757P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q9Y3B8 |
Synonym | 1810038D15Rik AW107347 CGI 114 DKFZP566E144 MGC105914 MGC111570 mitochondrial Oligoribonuclease Oligoribonuclease, mitochondrial [Precursor] ORN_HUMAN REX2, RNA exonuclease 2 homolog (S. cerevisiae) REXO2 RFN RNA exonuclease 2 RNA exonuclease 2 homolog SFN Small fragment nuclease Smfn |
Description | Recombinant Human REXO2 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSVREGGAAMAAGESMAQRMVWVDLEMTG LDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCKEHHG KSGLTKAVKESTITLQQAEYEFLSFVRQQTPPGLCPLAGNSVHEDKKFLD KYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDISE SIKELQFYRNNIFKKKIDEKKRKIIENGENEKTVS |
Molecular Weight | 27 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |