Recombinant Human Ret (mutated R813 Q) Protein
Beta LifeScience
SKU/CAT #: BLA-7728P
Recombinant Human Ret (mutated R813 Q) Protein
Beta LifeScience
SKU/CAT #: BLA-7728P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P07949 |
Synonym | C ret Cadherin family member 12 Cadherin related family member 16 CDHF 12 CDHF12 CDHR16 ELKS Fusion gene HSCR 1 HSCR1 Hydroxyaryl protein kinase MEN2A MEN2B MTC 1 MTC1 Multiple endocrine neoplasia and medullary thyroid carcinoma 1 Oncogene RET Proto oncogene tyrosine protein kinase receptor ret Proto-oncogene c-Ret Proto-oncogene tyrosine-protein kinase receptor ret PTC RET RET ELE1 Ret Proto oncogene RET transforming sequence RET_HUMAN RET51 RET9 tyrosine-protein kinase receptor ret |
Description | Recombinant Human Ret (mutated R813 Q) Protein was expressed in Baculovirus infected Sf9 cells. It is a Protein fragment |
Source | Baculovirus infected Sf9 cells |
AA Sequence | CYHKFAHKPPISSAEMTFRRPAQAFPVSYSSSGARRPSLDSMENQVSVDA FKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVK MLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAK YGSLQGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTMGDLISFAWQI SQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKR SQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPE RLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKM MVKRRDYLDLAASTPSDSLIYDDGLSEEETPLVDCNNAPLPRALPSTWIE NKLYGMSDPNWPGESPVPLTRADGTNTGFPRYPNDSVYANWMLSPSAAKL MDTFDS |
Molecular Weight | 51 kDa including tags |
Purity | >70% Densitometry. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The specific activity of this recombinant protein was determined to be 90 nmol/min/mg as per activity assay protocol. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |