Recombinant Human Renalase Protein
Beta LifeScience
SKU/CAT #: BLA-7706P
Recombinant Human Renalase Protein
Beta LifeScience
SKU/CAT #: BLA-7706P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q5VYX0 |
Synonym | 6530404N21Rik AI452315 AW060440 C10orf59 Chromosome 10 open reading frame 59 FLJ11218 HGNC:25641 Hypothetical protein LOC55328 MAO C MAO-C mMAO C Monoamine oxidase C Monoamine oxidase-C Renalase Renalase FAD dependent amine oxidase RNLS RNLS_HUMAN |
Description | Recombinant Human Renalase Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKADDSGGRMTTACSPH NPQCTADLGAQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKE GDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDDKWEVSKQTGS PEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFY EAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGPSLVIHTTVPF GVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANC PGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI |
Molecular Weight | 64 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |