Recombinant Human REG4 Protein
Beta LifeScience
SKU/CAT #: BLA-7699P
Recombinant Human REG4 Protein
Beta LifeScience
SKU/CAT #: BLA-7699P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q9BYZ8 |
Synonym | Gastrointestinal secretory protein GISP Reg IV REG like protein REG-4 REG-like protein Reg4 REG4_HUMAN Regenerating gene type IV Regenerating islet derived family member 4 Regenerating islet derived protein 4 precursor Regenerating islet-derived protein 4 Regenerating islet-derived protein IV REGIV RELP |
Description | Recombinant Human REG4 Protein was expressed in Mammalian. It is a Full length protein |
Source | Mammalian |
AA Sequence | DIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILS LKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKS MGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRPVDHHHHHH |
Molecular Weight | 17 kDa including tags |
Purity | >95% SDS-PAGE.Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |