Recombinant Human REG3G Protein
Beta LifeScience
SKU/CAT #: BLA-7696P
Recombinant Human REG3G Protein
Beta LifeScience
SKU/CAT #: BLA-7696P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q6UW15 |
Synonym | LPPM429 Pancreatitis-associated protein 1B Pancreatitis-associated protein IB PAP IB PAP-1B PAP1B PAPIB REG III Reg III-gamma REG-3-gamma REG3G REG3G_HUMAN Regenerating islet derived 3 gamma Regenerating islet-derived protein 3-gamma Regenerating islet-derived protein III-gamma UNQ429 |
Description | Recombinant Human REG3G Protein was expressed in HEK293. It is a Full length protein |
Source | HEK293 |
AA Sequence | EETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKL VSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTD VMNYFAWEKNPSTILNPGHCGSLSRSTGFL KWKDYNCDAKLPYVCKFKDVDHHHHHH |
Molecular Weight | 18 kDa including tags |
Purity | >95% SDS-PAGE.Determined by SEC-HPLC and reducing SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle. |