Recombinant Human REG1 alpha Protein
Beta LifeScience
SKU/CAT #: BLA-7693P
Recombinant Human REG1 alpha Protein
Beta LifeScience
SKU/CAT #: BLA-7693P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P05451 |
Synonym | ICRF Islet cells regeneration factor Islet of Langerhans regenerating protein Lithostathine Lithostathine 1 alpha Lithostathine 1 alpha precursor Lithostathine-1-alpha MGC12447 P19 Pancreatic stone protein Pancreatic stone protein secretory Pancreatic thread protein Protein X PSP PSPS PSPS1 PTP RATRGPI REG REG-1-alpha Reg1 REG1A REG1A_HUMAN Regenerating islet derived 1 alpha Regenerating islet derived 1 alpha pancreatic stone protein pancreatic thread protein Regenerating islet-derived protein 1-alpha Regenerating protein I alpha |
Description | Recombinant Human REG1 alpha Protein was expressed in HEK293. It is a Full length protein |
Source | HEK293 |
AA Sequence | QEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNL VSVLTQAEGA FVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSV NPGYCVSLTS STGFQKWKDVPCEDKFSFVCKFKNVDHHHHHH |
Molecular Weight | 17 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Please see notes section. |