Recombinant Human REA Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-7684P
Recombinant Human REA Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-7684P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q99623 |
Synonym | B cell receptor associated protein BAP37 B-cell receptor-associated protein BAP37 BAP Bap37 BCAP 37 D prohibitin D-prohibitin p22 Phb2 PHB2_HUMAN PNAS 141 Prohibitin 2 Prohibitin-2 Repressor of estrogen receptor activity |
Description | Recombinant Human REA Protein (denatured) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMAQNLKDLAGRLPAGPRGMGTALKLLL GAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQY PIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLD YEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSL ILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQ AEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADN LVLNLQDESFTRGSDSLIKGKK |
Molecular Weight | 36 kDa including tags |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |