Recombinant Human RCL Protein
Beta LifeScience
SKU/CAT #: BLA-7678P
Recombinant Human RCL Protein
Beta LifeScience
SKU/CAT #: BLA-7678P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | O43598 |
Synonym | 2' deoxynucleoside 5' phosphate N hydrolase 1 BC048355 c Myc responsive c Myc responsive protein Rcl c-Myc-responsive protein Rcl C6orf108 C76683 Chromosome 6 open reading frame 108 Deoxyribonucleoside 5' monophosphate N glycosidase Deoxyribonucleoside 5''-monophosphate N-glycosidase dJ330M21.3 DNPH1 MGC54855 Putative c Myc responsive Rcl RCL_HUMAN RP3 330M21.3 |
Description | Recombinant Human RCL Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMAAAMVPGRSESWERGEPGRPALYFCGSIR GGREDRTLYERIVSRLRRFGTVLTEHVAAAELGARGEEAAGGDRLIHEQD LEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAM IRGAADGSRFQVWDYEEGEVEALLDRYFEADPPGQVAASPDPTT |
Molecular Weight | 21 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |