Recombinant Human RB1 Protein
Beta LifeScience
SKU/CAT #: BL-4498PS
Recombinant Human RB1 Protein
Beta LifeScience
SKU/CAT #: BL-4498PS
Catalog No.: BL-4498PS
Product Overview
| Tag | His |
| Host Species | Human |
| Synonym | RB, OSRC, RB-1, RB1, p105-Rb, OSTEOSARCOMA, RETINOBLASTOMA-RELATED,PP110, Retinoblastoma-associated protein. |
| Background | Retinoblastoma (RB) is an embryonic malignant neoplasm of retinal origin. It almost always presents in early childhood and is often bilateral. Spontaneous regression ('cure') occurs in some cases. Retinoblastoma acts as a regulator of other genes and forms a complex with adenovirus e1a and with sv40 large t antigen. Retinoblastoma acts as a tumor suppressor and modulats functionally certain cellular proteins with which t and e1a compete for pocket binding. Retinoblastoma is potent inhibitor of e2f-mediated trans-activation, recruits and targets histone methyltransferase suv39h1 leading to epigenetic transcriptional repression, inhibits the intrinsic kinase activity of taf1. |
| Description | Retinoblastoma Human Recombinant fused with 6X His tag expressed in E.Coli is a single, non-glycosylated, polypeptide chain containing 146a.a. and having a molecular weight of 16.5 kDa.The Retinoblastoma is purified by unique purification methods. |
| Source | E.coli |
| AA Sequence | MASFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEKHHHHHH. |
| Purity | >95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Endotoxin | <1.0 EU per μg by the LAL method. |
| Formulation | The RB1 (1 mg/ml) was lyophilized after extensive dialyses against 1xPBS pH-7.4. |
| Stability | Recombinant protein is stable for 12 months at -70°C |
| Usage | For Research Use Only |
| Storage | Lyophilized Retinoblastoma although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Retinoblastoma should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
